SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9N8P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9N8P6
Domain Number 1 Region: 163-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.71e-55
Family Methylesterase CheB, C-terminal domain 0.0000442
Further Details:      
 
Domain Number 2 Region: 17-137
Classification Level Classification E-value
Superfamily CheY-like 3.56e-25
Family CheY-related 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9N8P6
Sequence length 353
Comment (tr|A0A0C9N8P6|A0A0C9N8P6_SPHPI) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1219050 OS=Sphingomonas paucimobilis NBRC 13935. GN=SP6_11_00460 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MASSLHPTCASPDACTRILIVDDSAVARALIARQIEPWSRFAVVGAVTHVEAALAFLAQH
EVDIILLDVAMPGMDGITALPKLLTAGQGARIIIVSSSTPAGGAAAVQALAHGAADTLVK
PKPQGLSEFSDALLHKLEALAVPQDRTGGPSRPFAPPVTRTAMPDIIGIGASTGGIHALA
KLLAPLPETMTVPIVVTQHLPASFMSYFAAQLAAVARRPCDIAEDRMRLRPGRVVVAPGD
AHMTFTPLPDGGAAIRLQHERASSGCLPSVDPMFAAMARVWGPRALGIVLTGMGRDGLDG
AQVLKAAGGTIVAQDEASSVVWGMPGAIVAHDLADMVLPPDAIGAMLALGTRP
Download sequence
Identical sequences A0A0C9N8P6
WP_007404183.1.14240 WP_007404183.1.53903 WP_007404183.1.54864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]