SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9NT50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9NT50
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000327
Family FlgN-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9NT50
Sequence length 166
Comment (tr|A0A0C9NT50|A0A0C9NT50_9BACT) Flagella synthesis protein {ECO:0000313|EMBL:GAN35090.1} KW=Complete proteome; Reference proteome OX=1197129 OS=Candidatus Brocadia sinica JPN1. GN=BROSI_A3636 OC=Candidatus Brocadiaceae; Candidatus Brocadia.
Sequence
MNTLLDKLTETIDRLSIIYDELLETAKTKQCCLISGNIEELEMLLYQEKNQTEIAQLLEE
KRQNIINSYCKENHAQRKNVTMRSLMNNMDNLHRERVGSLLNKLTLSMKQLQQVNQTNTT
LTHYSLDITEDIIKIFCPSAFQYSVYHHTGKIQEHEMPMVLIDTEI
Download sequence
Identical sequences A0A0C9NT50 A0A136M1C7
WP_052565074.1.87291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]