SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9PWQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9PWQ9
Domain Number 1 Region: 32-252
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.04e-46
Family Protein prenylyltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9PWQ9
Sequence length 263
Comment (tr|A0A0C9PWQ9|A0A0C9PWQ9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:GAN31902.1} KW=Complete proteome; Reference proteome OX=1197129 OS=Candidatus Brocadia sinica JPN1. GN=BROSI_A0406 OC=Candidatus Brocadiaceae; Candidatus Brocadia.
Sequence
MKKILFLILFNFLNVVNGYSADNFGGFDVHYQLGNEYNKSGMIEDAIVEYKKAIEINAGS
AKAYNNLGVAYSKKKLFDEEIFAYKKAIELDRNYRDAYFNLGIAYGAKGMVDDEIRTYQK
VIELDSENFEALYNLGHAYREKEMHDESIAAYKRVIEIDPNYIDAYFNLGVSYGKKGLLD
DEILQYKKVLDLNPNSAEAHFNLGIAYGEKRMYEEQVREYKKAIAINPKYAKAYKNLESI
YREKGMKEDADKELSKYNDLVKH
Download sequence
Identical sequences A0A0C9PWQ9 A0A136MBB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]