SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9RIJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9RIJ7
Domain Number 1 Region: 240-424
Classification Level Classification E-value
Superfamily MIR domain 9.59e-59
Family MIR domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 425-595
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-51
Family IP3 receptor type 1 binding core, domain 2 0.000000391
Further Details:      
 
Domain Number 3 Region: 1108-1136,1174-1286
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.44e-36
Family IP3 receptor type 1 binding core, domain 2 0.0061
Further Details:      
 
Domain Number 4 Region: 109-216
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000327
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 842-910,1408-1558,1602-1705,1934-2106
Classification Level Classification E-value
Superfamily ARM repeat 0.0000547
Family Plakophilin 1 helical region 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9RIJ7
Sequence length 2725
Comment (tr|A0A0C9RIJ7|A0A0C9RIJ7_9HYME) Itp-r83A_0 protein {ECO:0000313|EMBL:JAG82819.1} OX=64838 OS=Fopius arisanus. GN=g.32227 OC=Ichneumonoidea; Braconidae; Opiinae; Fopius.
Sequence
MGEILGSASFLHLGDIVSLYAEGNVSGFLSTLGLVDDRCVVCPEAGDLSNPPKKFRDCLF
KICPMNRYSAQKQFWKAAKQSGSSSTDAVLLKRLHHAAEIEKKQNETENKKLLGTVVSYG
NVVQLLHLKSNKFLTVNKRLPALLEKNAMRVYLDANGNEGSWLYIMPFYKLRSDGDSVVV
GDKVIMEPVNAGRQGLHVAANYELSDNPGCKEVNVVNASTSWKVTLFMEHRENQEEILKG
GDVVRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGA
GHWNSLFRFKHLATGQYLAAEIDTDEPPEMIKGKREPPGAIYRLVSVPHSNEISSLFELD
PTTLTRGDSLVPQSSFVRLHHICTNTWVHSTSVPIDKDDEKPVMSKVGCAISKEDKEAFA
LRSVSPVEVRDLDFANDACKVLAAISGKLEKGTISHNERRAVTSLLQDIVYFIAGLENEQ
NKSEALELIVTNAVRDRQKLLREQYILGQLFKILQAPFLESAAGEGPFLRIEELNDPRHA
PYKYMFRLCYRILRLSQQDYRKNQEYIAKHFAFMQKQIGYDILAEDTITALLHNNRKLLE
KHITAAEIETFVGLVRKNMFNWESRFLDYLSDLCISNKKAIAVTQELICKSVLSEKNKDI
LIETRMFKTQVEVEEEVDERQDGESRITILEELEVLLVWNNGKRSMSLGELSRGAKMGNI
EDAAILDYYRHQLNLFSNMCLNRQYLALNSLSPHLGIDLILKCMEDETVPYELRASFCRL
MLHLHVDRDPQEQVTPVKYARLWSEIPSQMSINDYDTNKMPDENKEAVRARFSQTIIFVE
DYLCNVVARMWSFGDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTRTLLSILDCVSEN
DCPDGKIPTGEIDSEGGVLRCIGDMGAVMTSLTLGPAGPVIAGSTSPRPKSSTKKEYPLV
MDTKLKIIEILQFILDVRLDYRISCLLSIFKQEFDENEKASGDVNLGQKGIDLESIGQQA
EGIFGSSDECVALDLDGQGGRTFLRVLLHLAMHDYPPLVSGALHLLFRHFSQRQEVLQAF
KQVQLLVSDSDVESYKQIKADLDVLRQSVEKSELWVYKSKSTEEHSGGKKKKSTKDDEED
AGATPRKPAPQLSSSDKKGSAIDLDVGPPLHPEQADEYRKIQQILIRMNKLCIQAVPGGG
VKPRKHEQRLLRNVGVHTIVLDLLQVPFDAKEDIRMNELMRLAHDFLQNFCLGNQQNQIL
LHKQLDLFLNPGIREAQTVCSIFQDNSTLCNEVSAKVIQHFVHCIETHGKHVQYLKFLQT
IVKAENQFIRKCQEMVMQELVQAGEDVLVFYNDRASFNHFVEMMRSERFRMDESSPLKYH
VELVKLLACCTMGKNVNTEIKCHSLLPLDDIVAMVSHSDCLPEVKEAYINFLNHCYIDTE
VEMKEIYTSNHMWSLFEKSFIVDMSLIATATHDRNHADVALENYVTNCLMNIITTFFSSP
FSDQSTTVQTRQPIFVQLLHAAFEVSQCAWLNAGQRFNVENCIRTLSDVAKGRGIAIPTD
LECQVATMFNKAAMLSRQTTKWLQAAKQPKIERSQSQQLMRLDRSIIEGLQDIVSLLEEQ
LKPLVQSELSLLVDILYRPELLFPVGTDARKRCENGGFIRRLIKHTEKLLEETEEKLCVK
VLRTLREMMAIDPEYGEKGEALRNNLLIRYFGKAFLQKSENVEIGVRNSTSVTHGPGAKL
LSRAGRTLHEVQSHLDREGASDLVVELVIKSVHSPSIFVEAVELGIALLEGGNPIIQKSV
FSKLMGDDLSQSFFKVFNEKMKDSQQEIKATVTVNTSDIAAKAHEDKEQNKELEKISKKR
LSTKPNGIVITEELREELNQAAASTAQAYANVRTLASGEDISNNAALGYALEDMLAEKLD
RHRGNSSEREEGLLSAKVLVMQPILRFLQLLCENHNRDLQNYLRNQNNKTNFNLVSETLM
FLDCICGSTTGGLGLLGLYINEHNVALINQTLETLTEYCQGPCHDNQNCIATHESNGLDI
ITALILNDINPLGKTRMDLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVDVA
CRAFHQESLDEDPDSDDASTDSDEGVSPKEVGHNIYILCHQLAHHNKELATMLRPSELNN
ADPKINKALKYYATHTSQIEIVRHDRTLEQIVFPIPEICELITLDTKMKVLHTAERDDQG
SKVSDFFERTEDMFNEMKWQKKLRGQPMLFWMSSYMSLWSNLLFNCAVLINLIVAFFYPF
VDNVPKLIIPQLSGLIWTVMLSSGAIVLTLPRVTGIRTLAASTILRLIFSIGPEPTLMLL
GFTTIIFKIVHMISIIGNQGTLTKSAQQIITNAELWYHAVYLMFCVLGICMHPFFYSVLL
FDVVYREETLLNVIRSVTRNGRSIILTAVLALILVYMFSIIGYMFFKDDFLVGVDEEIIS
QVPMGTCESGSCEATETLSRYVQEVNEKQSAEMVSVGGEMKERACDSLVMCIVTTLNQGL
RNGGGIGDVLRAPSSTEPLFVARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQQK
ELILKNTCFICGLNRSAFDNKTVSFEEHIKHEHNMWHYLYFIVLVKVKDPTEFTGPESYV
YAMVKDRNLDWFPRLRAKSLAADEGEGEQVELRSLQSQLESTQLLVKCLSQQLTELRDQM
TEQRKQKQRLGLLNSASAFLHNPPT
Download sequence
Identical sequences A0A0C9RIJ7
XP_011307122.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]