SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9SZH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9SZH1
Domain Number 1 Region: 150-210
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000824
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9SZH1
Sequence length 238
Comment (tr|A0A0C9SZH1|A0A0C9SZH1_9MICC) Serine/threonine protein kinase {ECO:0000313|EMBL:KII26707.1} KW=Complete proteome; Reference proteome OX=1349820 OS=Arthrobacter sp. AK-YN10. GN=M707_26265 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
IYSVVNAAPPAPAKVAVPAVANMSESQALQELYGAKLVPKTTRVASDTVAKDMAIGTSPD
AGAMLEQNAEVVLNISSGPSSVTIPKDIAGRTESDARDYLKRLGITGAISTVRTHSPTVP
FGLVITTGPAPGAPIAAGSNVELQVSSGRVLMPQLAGLTQAEAEALLKENGLLMAVVEQE
NTQVEPGKVTAQSDAANTEVEQGKTITVTLAKAPAPEPTPTSKPTETDKPKPTPTKKD
Download sequence
Identical sequences A0A0C9SZH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]