SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9V6N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9V6N4
Domain Number - Region: 61-135
Classification Level Classification E-value
Superfamily Synuclein 0.051
Family Synuclein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9V6N4
Sequence length 210
Comment (tr|A0A0C9V6N4|A0A0C9V6N4_9HOMO) Unplaced genomic scaffold SPHSTscaffold_142, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ33130.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_265006 OC=Sphaerobolus.
Sequence
MSHRHSGRRTQADELSMQAVEGGEPIPGLTAGDLMNLPSTSADPQQSPEVLNLEHPDEPH
VQAYGTQTVPSQVQLPLRVAGPSNTATQGLSPTRLAGAVDTANRSLDSPRRVAVASGTAT
QGSYSPRGMDQGSGLWQNLGDAPSEPDRVSPDGGYTDEENFTIPASEVSILHQEYTDFIN
LKDNAEIVLSEAMEATEQLNTVQPHQDIYE
Download sequence
Identical sequences A0A0C9V6N4
jgi|Sphst1|265006|gm1.26896_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]