SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9YQW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9YQW3
Domain Number 1 Region: 4-300
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-73
Family Capz alpha-1 subunit 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9YQW3
Sequence length 313
Comment (tr|A0A0C9YQW3|A0A0C9YQW3_9HOMO) Unplaced genomic scaffold scaffold_12, whole genome shotgun sequence {ECO:0000313|EMBL:KIK27435.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_674788 OC=Pisolithaceae; Pisolithus.
Sequence
MNQDDERIAAASSFILQSPPGEINDVLHDVRVIVNGVRSAEEVLPGDHSSVQWTDPQEEK
LAQGILPALRDYNLTQFITVDVPGTSHQTIVSDIARIPSNDEDQERFLDPRSKTSFKFDH
LSLEATDSRPAELDVDAEPLRAALESSTLSYLAAHYRSGVVAVFSVQPPSQFIVQIVANK
YNPSNYWSGRWRSQYHIDFDSQTIRGKVLVNVHYYEQGNVQLETSHDLTIPIPPAVANAE
PSSASSKILALIDIEESRLQRSFNDAYHEMAEKTFKGLRRALPLTRQKIDWDKVLGYKLG
AELTAGKGVFTTS
Download sequence
Identical sequences A0A0C9YQW3
jgi|Pismi1|674788|fgenesh1_kg.12_#_84_#_Locus3268v1rpkm57.95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]