SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9YW84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9YW84
Domain Number 1 Region: 352-540
Classification Level Classification E-value
Superfamily MIR domain 6.28e-62
Family MIR domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9YW84
Sequence length 780
Comment (tr|A0A0C9YW84|A0A0C9YW84_9HOMO) Unplaced genomic scaffold scaffold_126, whole genome shotgun sequence {ECO:0000313|EMBL:KIK18234.1} KW=Complete proteome; Reference proteome OX=765257 OS=Pisolithus microcarpus 441. GN=PISMIDRAFT_109870 OC=Pisolithaceae; Pisolithus.
Sequence
MSSEDTSARRRVAKGPGCSGGFMSGSDYDTDPLQYDDHKDGHSKLRPPIGGRVSSGRLHK
PYPTPPTSISDFIHQNLEHLPPAIYTLLSCWTRFHKIGLADIVVWDEAHFGKFGSHYLKR
EFYFDVHPPLGKMLVAFAGLLSGYDGNFEFKSGEKYPDTVPYVAMRVMMATFGVALVPLG
WYTAVELGLSPWACHLVALMVLCDVAWLCISRFILLDSMLLFFTFTTVFFLTKFHNQQYQ
SFSFDWWLWLALTGISIGCVTSVKWVGLFVTAVVGIYTIEDLWDKFGDLRMSTRNQLRHW
GARILCLILLPILVYMTFFKLHFLILNHTGPGDAQMSSLFQAHLVGNDFWRNPLEVAYGS
KITLKNMGWGGGLLHSHVQTYPSGSTQQQVTCYHYKDDNNHWLVLPRWNGPAYNPNEELR
FVKNGDVIRLQHAPTTRSLHSHPIPAPITKLNYEVSCYGNSTVGDVQDHWVIEVVDDIRQ
GKKESLDRIRSLTTRARLRHEVLGCYLSAANKVLPQWGFKQIEVSCVKENDPDDIHTYWN
VESHWNDRLPAGDVKHYKSAFLRDFWHLNVAMMTSNNALVPDPDKDDILASHPTDWPWLR
LGLRMCGWGDNQPKYYLLGTPLVWWGGTLSLIVFVALLGIYLVRWQRRYVDMDATGWAHF
LYVGKVAFYGWFLHYAPFFIMGRVTYLHHYLPTLYFSVLMSAHVMDHCIFSARWKEKTKR
ILFGVTAFAIVANFWWFRGMAWGIEGPVNEYWGLQWRKVGFFSVVMEACDDNWSAIRLSF
Download sequence
Identical sequences A0A0C9YW84
jgi|Pismi1|109870|e_gw1.126.60.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]