SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0A8Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0A8Q0
Domain Number 1 Region: 403-591
Classification Level Classification E-value
Superfamily MIR domain 1.7e-59
Family MIR domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0A8Q0
Sequence length 816
Comment (tr|A0A0D0A8Q0|A0A0D0A8Q0_9HOMO) Unplaced genomic scaffold CY34scaffold_27, whole genome shotgun sequence {ECO:0000313|EMBL:KIK46490.1} KW=Complete proteome; Reference proteome OX=930992 OS=Suillus luteus UH-Slu-Lm8-n1. GN=CY34DRAFT_800343 OC=Suillus.
Sequence
MRPPQVQIDFGTPPGSPPRTSSEFEEIPYPATHPFYSTNSQSYKHEESLPLHHMNEDTSA
RRRVARGPGSSGGFMSGDEHENEMHYDDDGKDVYSKLRPARSRVSSGRVHRPPPPPPTSI
SEFISQNLEHLPPVIYTLLSCWTRFHKIGLANTVVWDEAHFGKFGSHYLKREFYFDVHPP
LGKMLVGLAGLLSGYDGHFEFKSGVTYDENVPYVAMRVMMATFGVALVPLGWYTAVELGM
SSWSCHLVALMVLCDVAWLAISRFILLDSMLLFFTFTTVFLLTKFHNQQYQSFSFDWWMW
LAFTGISIGCVTSVKWIGLFVTAVVGLYTIEDLWDKFGDLRMTNRDQIRHWAARVACLIV
LPILVYMLSFKLHFLILNHSGPGDSTMSSLFQAHLVGNDFGKNPREIAFGSKITLKGMGW
GGGLLHSHVQTYPVGSGQQQVTCYHYKDDNNHWTVLPTWEAPEYNPNGELQFLQDGDVIR
LQHVPTTRHLHSHSVAAPVTKLNNEVSCYGNSTVGDFHDYWVIEVVDDIKQGTKEQITKI
HSLTTRLRFKHQALGCYLYASNAVLPQWGFKQLEVSCTKENDPEDMHTYWNVESHWNDRL
PSGDAKFYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASSPTDWPWMRLGLRMCGWG
DDQTKYYLLGTPVIWWGGTASLIVSVIVFGVYLLRHQRKYIDMTPQQWDHFLYVGKIAGY
GWFLHYFPFFIMGRVTYVHHYLPTLYFSVLMLAHLLDHFIFSARWKDSTKRVSFGICAFL
IVGNFWWFRGMAWGIDGPINDYWGLLWRKTWNIYNA
Download sequence
Identical sequences A0A0D0A8Q0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]