SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0BYW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0BYW8
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-36
Family Capz beta-1 subunit 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0BYW8
Sequence length 183
Comment (tr|A0A0D0BYW8|A0A0D0BYW8_9AGAR) Unplaced genomic scaffold GYMLUscaffold_61, whole genome shotgun sequence {ECO:0000313|EMBL:KIK55069.1} KW=Complete proteome; Reference proteome OX=944289 OS=Gymnopus luxurians FD-317 M1. GN=GYMLUDRAFT_248880 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Omphalotaceae; Gymnopus.
Sequence
MADLVDSMLDLMRRLPPTRTEENVSSLISICPDYADDLLGSVDQPLQLKTDRATGREYLA
CDYNRDGESYRSPWSNEYDPPLEDGTVSTPKLRKLEISANEAFDTYRTMKAASRVVSLRK
TMTPSASTKSSEPWGSIHFFEGAERGGQTPYMHHYVTMKKSSNDKEQKKKAGNAMWKPLW
EAA
Download sequence
Identical sequences A0A0D0BYW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]