SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0BYX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0BYX9
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-43
Family Capz beta-1 subunit 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0BYX9
Sequence length 120
Comment (tr|A0A0D0BYX9|A0A0D0BYX9_9AGAR) Unplaced genomic scaffold GYMLUscaffold_61, whole genome shotgun sequence {ECO:0000313|EMBL:KIK55084.1} KW=Complete proteome; Reference proteome OX=944289 OS=Gymnopus luxurians FD-317 M1. GN=GYMLUDRAFT_881148 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Omphalotaceae; Gymnopus.
Sequence
MADLVDSMLDLIRRLPPTRTEENVSLLISICPNYADDLLGSVDQPLQLKTDRATGREYLA
CDYNRDGESYRSPWSNEYDPPLEDGTLPTPKLRKLEISANEAFDTYREMYYEGGVSSVYL
Download sequence
Identical sequences A0A0D0BYX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]