SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0C8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D0C8Q4
Domain Number - Region: 28-57
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00217
Family Capz beta-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0C8Q4
Sequence length 62
Comment (tr|A0A0D0C8Q4|A0A0D0C8Q4_9HOMO) Unplaced genomic scaffold scaffold_1495, whole genome shotgun sequence {ECO:0000313|EMBL:KIK79302.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_161626 OC=Paxillus.
Sequence
NGVVQETYNDFFNGLDYLEALMAGDIKEEDIVIMFLIDGAQLYHNKASGCWISIWVIFDH
SC
Download sequence
Identical sequences A0A0D0C8Q4
jgi|Paxru1|161626|e_gw1.1495.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]