SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0DWU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0DWU3
Domain Number 1 Region: 344-535
Classification Level Classification E-value
Superfamily MIR domain 3.53e-61
Family MIR domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0DWU3
Sequence length 946
Comment (tr|A0A0D0DWU3|A0A0D0DWU3_9HOMO) Unplaced genomic scaffold scaffold_288, whole genome shotgun sequence {ECO:0000313|EMBL:KIK94406.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_828037 OC=Paxillus.
Sequence
MSASVRARRPATPPPGLPHITPSAHKYPPSLSRKDDLDADERREAALKGYGPTRRTHAPG
GLKITSAEWKLLVIVLMVATFVRLFRISKPNSVVFDEVHFGKFAARYIKTRYFVDVHPPL
AKLLITAAAFLFGFDGNFDFKDIGKAFVNTPYVAMRMVPATLGIATVPLAYLTLRALDCR
ATTALLASLFVTFENGLITQSRHILLDSPLVFFTALTIFFFVGFSNEDKQEPFTEQWWTW
LVLTGLSLGAVVSCKWVGLFTIATIGVCTVLQLWLLLGDLRVKPRTWARHFLARALCLIL
IPLLFYMSMFELHFMILGSSGEGDAFMSSEFRQTLGRGMQDTYADIALGSEVTIRHVNTQ
GGYLHSHAHEYPGGSHQQQITLYPHRDENNMWRILNATVDSYPQYDYATQPIEYIKHGSR
IKLRHIVTDKALHSHDVRPPVSDVDFQCEVSAYGQAGFVGDINDDWVIEIERGDESDKES
SKRVRTLRTHFKLRHLNTGCYLFSHKVKLPEWGFEQQEVTCNKNAVKKNSLWYIETAEKH
PQLPVSAAKVNYKIPGFLAKFLELQQVMWTTNAGLTDRHVYDSRPLTWPRLRRGINFWVK
DHRQIYLIGNPFIWWLSTASVLAYVLVRGFLILRAKRGYKDFENTKVVKYDTLCGFLFTG
YFLHYFPFFLMGRQLFLHHYFPALYFAILLSCAVFDFATSALRPKVRLQIAAVLAVVAIW
NFSKFSPLVYGDPWTKKNCASAQWVKTWDFACNEFLDDYGQYAGIQVPTPNKTASVATIG
GEPGGRAPIVVVEDEQPVISEANTAIPSGAVAEPGRDVFAKKVKSVPGGARAPGAVDEER
VFSVVNAEPTTDMPEKEEEVKGETRIQVQKQRQSERPVSVAVEEPPASGAKVEEEVKSEA
LTAATPEGPLGHEEALADQVAHELYPDRRDVPGDVDVGVQEPGDDV
Download sequence
Identical sequences A0A0D0DWU3
jgi|Paxru1|828037|fgenesh1_kg.288_#_7_#_Locus1873v1rpkm91.21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]