SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0H578 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0H578
Domain Number 1 Region: 15-198
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.28e-53
Family Methylesterase CheB, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 291-484
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.08e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00024
Further Details:      
 
Domain Number 3 Region: 1055-1223
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-40
Family Histidine kinase 0.00094
Further Details:      
 
Domain Number 4 Region: 1241-1360
Classification Level Classification E-value
Superfamily CheY-like 1.85e-30
Family CheY-related 0.029
Further Details:      
 
Domain Number 5 Region: 842-966
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-22
Family Heme-binding PAS domain 0.0052
Further Details:      
 
Domain Number 6 Region: 988-1067
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000175
Family Homodimeric domain of signal transducing histidine kinase 0.0027
Further Details:      
 
Domain Number 7 Region: 224-292
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000183
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0081
Further Details:      
 
Domain Number 8 Region: 749-855
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000159
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.08
Further Details:      
 
Domain Number 9 Region: 527-633
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000174
Family Heme-binding PAS domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0H578
Sequence length 1361
Comment (tr|A0A0D0H578|A0A0D0H578_9BURK) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1542965 OS=Burkholderia sp. MSHR3999. GN=KY49_945 OC=Burkholderiaceae; Burkholderia.
Sequence
MPKRRGQTLPSQADYPIVGIGASAGGLSALLEFFEALPAHTSMAFVVVVHLAPDHESNLA
SLLQKATGMPVLQVTTATPIQPDHVYLIAPSLELTMVDDYLRVAPSRPEEGGRRAAIDLF
FRTLAETHRERAIGIVLSGAGSDGSVGLSRVKEMGGITFAQDPAEAEYDSMPRSAIATGM
VDFVLTAAEMPQRLLDLWLTAKEIHLPAVEDEERQEDLMNESAERALREIMIILRTRTAH
DFRHYKRATVLRRIERRLQVNGITDLQAYRDYLHLHPDETQALLQDMLISVTNFFRDKET
FDVLEREVLPQFFEGRSEQDRIRVWSVGCATGEEAYSLAMLLQERSLKSSEGISFQVFAT
DIDERAISFARAGLYPDSILADVTAGRVRQFFSKDAAHYRIKKELREHMLFAHHNVLSDP
PFSRLDLICCRNLLIYLDREAQIEILKMFHFALRPGGVLFLGSSESADSVSSMFSVIDKR
NRIYRANVAVRGDTPMPVAITGTMSARPVVATVQLPGRRRFSFGDLHQRLVEQYAPPSVL
VNRDSEIVHLSDRAGRFLQYSGGEPSHNIIAAVRPELRLELRTAIYQALHTNRSVEARRV
RIERDARSYFVNMTARPVHDPEANADFVLVLFDEVEDSMSGGETATADTQKDPIITQLER
ELQRTKEQLQSTIEQSETSTEELKASNEELQAINEELRSATEELETSKEELQSINEELTT
VNAELKSKVEETGKINDDLQNLIAANDIGTIFVDRNICIKRYTPRATDVFSIIPSDIGRS
LLDITHRLEYDKLADDAAEAFDSLRLIERELKSNDGRWYLARFVPYRTTEDRIDGAVLSF
IDITDRRRAEERLREGERRMRIVTEGTKDYAIITFDDDGAITSWNAGAERIFGYAAAEMI
GQSAEVLSTDEDRAGHVAEREFAQARANGRIEEARWHRRKDGTRFFASGVLSRLDEPGVS
GFAKIARDLGESTQAATVGRDAQVEQLRVSREQDAERRRDEFLAVVSHELKNPLNLISAS
AELIARSPEARQSLNISRATETIRRTVIGQAQIIDDLLDVSRVRTGKLSVVRTPVDMREI
VRRVASAVQDESNQRGLALQVAMTESPVIILADLTRIEQVVWNLISNALKFTSHGRVDVS
LQVNGHAEAVLRVADTGSGIEPALLPHIFDMFRQSRDPAARRAGLGIGLALVRELVSLHG
GTVRAESEGAGRGATFTVTLPTHRAHADANAAGGMLAESLHGLHILMVDDDTETVETFKL
LLESEGAIVRTATSGEQALSMLDGNVPDVVLSDIGMPGMDGLAFVGKLREAPAMKSVICI
ALSGFGQEADVRLAEQAGFDAHLKKPVTLENLQSVFSRLRG
Download sequence
Identical sequences A0A0D0H578
WP_042587668.1.34318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]