SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0J346 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0J346
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily CheY-like 1.42e-27
Family CheY-related 0.00028
Further Details:      
 
Domain Number 2 Region: 180-207
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0000811
Family Methylesterase CheB, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0J346
Sequence length 207
Comment (tr|A0A0D0J346|A0A0D0J346_VIBHA) Chemotaxis protein CheY {ECO:0000313|EMBL:KIP65006.1} KW=Complete proteome OX=669 OS=Vibrio harveyi (Beneckea harveyi). GN=SN10_26305 OC=Vibrionaceae; Vibrio.
Sequence
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGREAVEKAKSLKPDVITMDIEMPV
MDGITAVREIMAASPTPILMFSSLTHDGARATLDALDAGALDFLPKKFEDIARNRDEAVS
LLQQRVIQIASKRAFMRRPIAKPAATTANSTTRPLASRSATPMASAPSRSMAAKFRASGK
KYQLTAIGTSTGGPVALQKILTRLPVN
Download sequence
Identical sequences A0A0D0J346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]