SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0NLT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0NLT9
Domain Number 1 Region: 191-375
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-63
Family Methylesterase CheB, C-terminal domain 0.00000804
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 5.83e-27
Family CheY-related 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0NLT9
Sequence length 377
Comment (tr|A0A0D0NLT9|A0A0D0NLT9_PSEFL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=RL74_07200 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVVKVLVVDDSGFFRRRVSEILSADTSIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPDKVRQ
LLCEKVHSISRSNRRVGGYSAPAPAPVAAPSPAPTSSASSSFNPPPVRSAPAPAPTRSAP
ASASSAAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAER
LDKLCNISVKEAEDGDILRPGLALLAPGGKQMMVDGRGAVKILPGDERLNYKPCVDITFG
SAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSAIWAQDEASCVIYGMPMAIVKADLAD
AVYSLDDIGRHLVEACL
Download sequence
Identical sequences A0A0D0NLT9
WP_042729124.1.35729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]