SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0NRM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0NRM1
Domain Number 1 Region: 17-119
Classification Level Classification E-value
Superfamily HisI-like 1.57e-46
Family HisI-like 0.0000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0NRM1
Sequence length 124
Comment (tr|A0A0D0NRM1|A0A0D0NRM1_KITGR) Phosphoribosyl-AMP cyclohydrolase {ECO:0000256|HAMAP-Rule:MF_01021, ECO:0000256|SAAS:SAAS00976554} KW=Complete proteome; Reference proteome OX=2064 OS=Kitasatospora griseola (Streptomyces griseolosporeus). GN=TR51_20815 OC=Kitasatospora.
Sequence
MSTNPAAPGSTALDPAIAARLKRTADGLLPAVAQQYDTGEVLMLGWMDDEALHRTLTTGR
CTYWSRSRSEYWVKGDTSGHFQHVKHVALDCDGDTLLVKVDQVGAACHTGDRTCFDADVL
PLSR
Download sequence
Identical sequences A0A0D0NRM1
WP_043913425.1.87630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]