SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0PAZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0PAZ1
Domain Number 1 Region: 801-1173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.65e-122
Family PFOR PP module 0.00000001
Further Details:      
 
Domain Number 2 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.12e-73
Family PFOR Pyr module 0.000000161
Further Details:      
 
Domain Number 3 Region: 423-673
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-72
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000705
Further Details:      
 
Domain Number 4 Region: 256-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.57e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000168
Further Details:      
 
Domain Number 5 Region: 670-842
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1e-22
Family Ferredoxin domains from multidomain proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0PAZ1
Sequence length 1181
Comment (tr|A0A0D0PAZ1|A0A0D0PAZ1_9GAMM) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome OX=1588629 OS=Aeromonas sp. L_1B5_3. GN=RW26_06140 OC=Aeromonadaceae; Aeromonas.
Sequence
MITTDGNNAVASVAYRTSEVIAIYPITPSSAMAEQSSAWSSERGKNLWGDVPRVVEMQSE
GGAIAAVHGALQTGALATSFTSSQGLLLMIPNLYKLAGQLIPFVLHVAARTVATHTLSIF
GDHSDVMAVRQTGCAMLCASNVQEAQDFALISQIASLNSRLPFIHFFDGFRTSHEIAKIA
PLADNTLRALLPADAIRAHRDRALTPDKPVIRGTAANPDTYFQCREASNPWYDAAYGHVS
EAMQAFGEQTGRHYRPFEYVGHPQAERIVVLMGSAIGTCEEVIERLLAQGEKVGLVKVRL
FRPFSAEHLLAAIPKSARTIAVLDRTKEPGAQAEPLYLDVMTALAEAVSRGERASLPRVI
GGRYGLSSKEFGPACALAVFAELAQENPRPRFTVGIFDDITGLSLPLPALNSHSPIHSQQ
HKLEALFYGLGSDGTVSAAKNSIKILGNHTDLYPQGYFVYDSKKAGGLTVSHLRVGERPL
QSAYLVEEADFIGCHQWQFVDKYRMAERLKAGGIFLLNTPYSEAEIWQRLPSEVQHALRE
KEARFYIINAAKIARDCQLGNRINTVMQMAFFQLSAIIPHAEATSLLKQAIATSYGSKGQ
TLVERNWQALEATCAALTRVQLGELDPASRPRPPVVSAKAPDFVQTVTAAMLAGLGDSLP
VSAFPPDGTWPVGTTRWEKRNIAKEIPIWEAELCTQCNYCVAACPHSAIRAKVVEADSLA
AAPTTLDALDVKSRDMRGQQYVLQVAPEDCTGCNLCVEVCPAKDRSNPDRKAINMASRLD
HLDEQKANYDFFLDLPERSAEQLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLY
GDRLLIANATGCSSIYGGNLPTTPYTTNAEGRGPAWANSLFEDNAEFGLGFRLTVDQHRE
RVRRLLASLGDTIPEALREALGDANQPVSEQRAHIQQLRALLQGSQTPAAHELARDADYL
VEKSVWLIGGDGWAYDIGFGGLDHVLSLGENINVLVLDTQCYSNTGGQQSKATPLGAITK
FGEQGKRKGRKDLGASVMMYGHVYVAQISLGAQMNQTVKAIQEAEAYPGPSLIIAYSPCE
EHGYDMAESHEQMKQLTATGFWPLYRFDPRRADEGKLPLALDSRAPNASLAETLRHEPRF
QRLERQLPEVASQLYEEAEQEANRRFAWLSQLAGKESPAQE
Download sequence
Identical sequences A0A0D0PAZ1
WP_043850125.1.43385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]