SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0R9N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0R9N9
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-28
Family Tissue inhibitor of metalloproteinases, TIMP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0R9N9
Sequence length 178
Comment (tr|A0A0D0R9N9|A0A0D0R9N9_9BACI) Contig51, whole genome shotgun sequence {ECO:0000313|EMBL:KIQ86005.1} KW=Complete proteome OX=1586646 OS=Bacillus sp. L_1B0_5. GN=RT27_17955 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MFPVIIICSFILIIFPEKSYACDCIKVSTEDAFQKNDVVFEGKVIEVGRKEEVGTEVLFE
VKKIWKGTTSSQIIVYTKGGDCMFRFVEGGEYLVFSTQRGSEKQLHTHSCSGTKRLDEAG
ADKSVLSQIAKESVPTKKVDLKGEMVSGLSLWQVAIISMGLLWIIAFVIFIVRKTRKK
Download sequence
Identical sequences A0A0D0PZB1 A0A0D0R9N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]