SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0VGM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0VGM7
Domain Number 1 Region: 5-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-78
Family Capz beta-1 subunit 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0VGM7
Sequence length 293
Comment (tr|A0A0D0VGM7|A0A0D0VGM7_CRYGA) Unplaced genomic scaffold supercont1.11, whole genome shotgun sequence {ECO:0000313|EMBL:KIR46566.1} KW=Complete proteome OX=1296109 OS=Cryptococcus gattii CA1280. GN=I312_04053 OC=Cryptococcus gattii species complex.
Sequence
MADPDQTFDSLLDLLRRLPPTRVEENVNALCDLAPEYADDLLGNVDQPLKVLVDEEKGRE
FLGCDYNRDGDSFRSPWTNKYLPESVPGPTPSPRLRELEVQLNAAFDTYREMYFEGGVSS
VYLWDLDDEPQGKEMNFAGVVLVKKSLQSQSDIPTAPAGSWDSLHVFECHERGRSAKYKL
TSTVMLVLETATLAKADNKGLEGPGGKGGVNLSGSMTRQAEIDYPLTTPQGHISNIGRMV
EDMEIKMRNLLSAVYFGKTKDVINELRSQSGLEAKSKEDLLRAELAGKLGGRK
Download sequence
Identical sequences A0A0D0VGM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]