SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0VUA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0VUA6
Domain Number 1 Region: 327-513
Classification Level Classification E-value
Superfamily MIR domain 3.4e-55
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0VUA6
Sequence length 767
Comment (tr|A0A0D0VUA6|A0A0D0VUA6_CRYGA) Unplaced genomic scaffold supercont1.2, whole genome shotgun sequence {ECO:0000313|EMBL:KIR50034.1} KW=Complete proteome OX=1296109 OS=Cryptococcus gattii CA1280. GN=I312_01129 OC=Cryptococcus gattii species complex.
Sequence
MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPSLRNEYIISWSTATALTIAAC
VVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKMLNGLAAWLVGFDGNFGF
DQIGDSYTDAGVPYVGMRNFCAILGSLTIPVVYAIMRESGYPVGIAAFSAALILFDNGHI
TQTRLILLDAALVLFMALSLFCYIKFHQYRYQEFSGAWWGWLLATGFWLACTLGCKMVGL
FTFVTVGAAVLWDLWEILDIKKGHSMSYWTKHFVYRAIGLIIVPFFIYLSFFWVHFKILK
FSGPGDTFMSPAFQETLQGNELLMNAQEIRYYDTITVRHKDTKQYLHSHDERYPLRYDDG
RISSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVRHNDVIQLKHINTQTLLLTHDV
ASPLMPTNQEFTTVSPDNEERRNDTLFKMVLNDAHDGEAWKTLSGHFRLIHVPTKVALWT
HPKALPEWAFGQQEVNGNKNSAERSTLWFVNDIVEDGQGFDFKNRTVQVEPKAVKKRAFI
KKWFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSGISFWTRNEGQQQIYMVGNLLGWWV
CAVTVSVYVGVVAADMLARRRGIHPIEDGVRNRLYRNTGFFLGAWAFHYLPFYLMSRQRF
LHHYLPAHLASVLVAGSVMNFILIEAVNYPISIAGPTTRLRPAVRAKLNKPAKMVIAGLL
IIVIGVYLFLSPLTYGQSMTGEEVNRRKLLSTWSLHFEAKKTHSLDE
Download sequence
Identical sequences A0A0D0VUA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]