SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0WS35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0WS35
Domain Number 1 Region: 393-582
Classification Level Classification E-value
Superfamily MIR domain 9.55e-59
Family MIR domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0WS35
Sequence length 807
Comment (tr|A0A0D0WS35|A0A0D0WS35_9TREE) Unplaced genomic scaffold supercont2.9, whole genome shotgun sequence {ECO:0000313|EMBL:KIR86012.1} KW=Complete proteome OX=1296105 OS=Cryptococcus gattii VGIV IND107. GN=I308_03543 OC=Cryptococcus gattii species complex.
Sequence
MHRGIPSPPATRRHTATQHTPWENRVPPSAYGSARPHSALLESTPHDDAELPLYKDTNME
LKRRFEEKQPVQLEQPVVDDDQGKWEKGYGAGPGIGGRRGLPPKQRIPGWKGIVLEHEEW
VWAGVYTLLSMITRFWRIGAANYVVWDEAHFGKFGTHYINRDFYFDVHPPLGKMLVGLAG
LLSGYQGNFEFKSGVAYPEDVPYTAMRVMLASFGVALVPLAWFTSGEMGWSRWARHWVTI
CVLCDIGWLCISRFILLDSMLLFFTFTTTLGLVKFRNQRHVPFSDDWWIWLVFTGWSIGC
VCSVKWVGMFITALVGLYTIEDLWEKFGDLSMPIRTYITHWIARIACLIILPFIVYASCF
KMHFLILNRSGPGDAQMSSLFQAHLRGNDFAESPLEIAYGSTVTLKNYGYGGGLLHSHVQ
TLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGPIRFLKDGDEIRLVHTQTGRNM
HSHAIAAPVTKESWEVSGYGNLTIGDANDLWVIEIVDDTHTSKKNNENGRIHSLTTRMRL
KHRELNCYLRAANTVLPQWGFKQVEVSCTKENNPKDLHTYWNVESHWNERLPPGNAKLYK
SPFWRDFVHLNVAMWTSNNALIPDPDKEDILASEPFDWPFLHLGLRMCGWGDHQIKFYLL
GTPIIWWFSTVSLAIGLGLAAWYVARMQRGYKEWKAGEWDHWLWVGKVAFGGWALHFFPF
LIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASPTRSHTKKLIWFTVWAGVVILSFWWF
KDLALGIYGNVNNHWGWGWRSSWNIYN
Download sequence
Identical sequences A0A0D0WS35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]