SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D0X1V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0X1V3
Domain Number 1 Region: 325-511
Classification Level Classification E-value
Superfamily MIR domain 3.4e-55
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0X1V3
Sequence length 765
Comment (tr|A0A0D0X1V3|A0A0D0X1V3_9TREE) Unplaced genomic scaffold supercont2.1, whole genome shotgun sequence {ECO:0000313|EMBL:KIR89542.1} KW=Complete proteome OX=1296105 OS=Cryptococcus gattii VGIV IND107. GN=I308_00550 OC=Cryptococcus gattii species complex.
Sequence
MSLAPRKRRTDRNESPPVRSYSEDDKQRTPKPPLSAPSLRNEYIISWSTATALTIAACVV
RFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKMLNGLAAWLVGFDGNFGFDQ
IGDSYTDAGVPYVGMRNFCAILGSLTVPVVYAIMRESGYPVGIAAFSAALILFDNGHITQ
TRLILLDAALVLFMALSLFCYIKFHQYRYQEFSRAWWGWLLATGFWLACTLGCKMVGLFT
FVTIGAAVLWDLWEILDIKKGHSMSYWTKHFFYRAIGLIIVPFFIYLSFFWVHFKILKFS
GPGDTFMSPAFQETLQGNELLMNAQEIRYYDTITVRHKDTKQYLHSHDERYPLRYDDGRI
SSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVRHNDVIQLKHINTQTLLLTHDVAS
PLMPTNQEFTTVSPDNEERRNDTLFKMVLNDAHDGEAWKTLSGHFRLIHVPTKVALWTHP
KALPEWAFGQQEVNGNKNSAERSTLWFVNDIVEDGQGFDFKNRTVQVEPKAVKKRAFIKK
WFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSGISFWTRNEGQQQIYMVGNLLGWWICA
VTVSVYVGVVAADMLARRRGIHPIEDGVRNRLYRNTGFFLGAWAFHYFPFYLMSRQRFLH
HYLPAHLASVLVAGSVMNFILIEAVNYPISIAGPTTRLRPAVRAKLNKPAKMVIAGLLII
VIGVYLFLSPLTYGQSMTGEEVNRRKLLSTWSLHFEAKKTHSLDE
Download sequence
Identical sequences A0A0D0X1V3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]