SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D1DBL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1DBL8
Domain Number 1 Region: 708-949
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0088
Further Details:      
 
Domain Number 2 Region: 15-213
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.59e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.061
Further Details:      
 
Domain Number 3 Region: 429-611
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000212
Family PFOR PP module 0.032
Further Details:      
 
Domain Number 4 Region: 272-392
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000247
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D1DBL8
Sequence length 1135
Comment (tr|A0A0D1DBL8|A0A0D1DBL8_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KIT17358.1} KW=Complete proteome; Reference proteome OX=935700 OS=Jannaschia aquimarina. GN=jaqu_10900 OC=Rhodobacteraceae; Jannaschia.
Sequence
MRQDVTLADRFDLGKKTVLLNGTQALVRLMLMQKERDRQAGLNTAGLVAGYRGSPLGAVD
LNMARATKMLAENDIKFQPALNEDFAVTMHWGAQQAELRGEGTHDGVFGLWYGKGPGVDR
SGDAMRHANMAGTSRNGGVLMAMGDDHTGESSTTCHQSDWALIDVHMPVMSPAGVQEILD
YGLYGWALSRYAGVWVGLKTMKDTIEVTSVVDGRPDRMSFVAPAEFDMPEGGLNIRLNDH
WVPQEERLLEHKRWAAEAFSHANGLDRRMHGKPGAKIGLVSHGKNWLDLVHAMALLGLDE
EECERLGITTYKVAQIWPMDMKGLHDWAEGLDLIICVEEKRKLLEVQVKESIFDDRQGRR
VIGYRDESGKVLFPQHFALDPTDIAIKLGEILKREGRGTDRIEAGLASAREAKRADNAPQ
IAGRTAWFCSGCPHNTSTKVPEGARAGAGIGCHVMALWMNRNTEGYTHMGAEGVNRIGES
MFSTRDHVFQNLGEGTYNHSGVLAIRAALAAGTNITYKILFNDAVAMTGGQQNEGDLQPQ
QIAAELLAMGVKELAVVYDEKEDVDKAAFPSGLTWHERAEMPQLQERMQQVKGVSAILYI
QTCAAEKRRRRKRGLFPDPDRRIFINTDVCEGCGDCGVQSNCVSLVPVETELGTKRAVDQ
STCNKDYSCVNGFCPSFVSVQGATLKKAPTTSVDTSGLPEPDLPAIDGTWNIVVTGVGGT
GVVTIGAVSAMAAHLDGKAAGLMEMAGLAQKGGAVALHLRLAERPEDISAIRVATGEADA
LIGGDLVVSASPKTLGQTSTGRTGAVVNAHEIVTGDFTGNPDFKLPADRLRLSLEARLRD
RLTMFDASRLAEKVLGDTIFSNMTILGAAWQMGLVPLSREAILKAVELNGAAVEKNQQAF
ELGRWAFAKPDQSAALLDEDRVLEMPKTLEQKIAFRADHLTAYQGKRLAKRYRKLVDGIS
DEALREAVAKGYHKLLAYKDEYEVARLLRQTRTKAEAAFDGDLKLTYHLAPPMLSKEGPD
GRPAKRAFGEWIERAYPWLARLKGLRGTPFDPFGRTEERRMERALIKQYEIDMAEVLPLF
DEATRDAVIALAELPLTIRGFGPVKHANAAKAEKRREELLSVIRSGGEGQRRAAE
Download sequence
Identical sequences A0A0D1DBL8
WP_043917943.1.14753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]