SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D1DPS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1DPS4
Domain Number 1 Region: 336-526
Classification Level Classification E-value
Superfamily MIR domain 4.84e-50
Family MIR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1DPS4
Sequence length 777
Comment (tr|A0A0D1DPS4|A0A0D1DPS4_USTMA) Chromosome 19, whole genome shotgun sequence {ECO:0000313|EMBL:KIS66439.1} KW=Complete proteome; Reference proteome OX=237631 OS=Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus). GN=UMAG_05433 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MVDATKAQTLRSRRNDSATAHTTDAVASTRADHSIVTDVKLGSKSNWGVVSPHVHSHAAD
SLITLVLFALAAALRLYRISFPDQVVFDEVHFGKFAAYYLRREFHFDVHPPLAKLINAFA
GYLAGFDGHFEFDQIGDKYLDNNVPYIRMRAVPAIIGSLQVPLVYAIMRQSGYAPVIGVF
SAALLLFDNAHIAQDRLILLDAPLILFMMLSLYSYIRFYKLRYNEFSSEWWVWLCATGVN
LALTMSCKMVGLFTFITIGSAVAWDLWKLLDIRRGLEIEHVARHFFARFFALILLPFGVY
LFWFWVHFAILIKSGPGDVFMSSQFQQTLTGNEMLSNARDIQYFDKLTLMHKNTKALLHS
HVERYPLKYDDGRISSQGQQVTGYPHNDTNNVWQIIPTKPIPDHDATGRLVHHKDTLRLL
HVNTDSYLLTHDVASPLMATNEEFTTVPANDTSRYDDTLFELHLDEADGTDKVVKSRASW
FRLVHKNTRVCMWTHGEALPDWAFNQQEVNGNKNAMDKTCLWYVEDLTPSPESPDYEERL
KPLAPRKVVKMNFFKKWLELQLQMLQQNAGLTQSHPYATGPINWPFLLQGISFWTQDAGQ
HQIYMIGNLVSWWGTILAISIFVGVVGADLLARRRAIYPIPSAVRNRLHNSSGFFVMAWA
CHYLPFFLMSRQLFIHHYLPAHVCACLVAGGVLNFVTSETIQFPISKPGPLLTPRHYRPR
MDNIVPQQARAFMALVIGALIVCFWWLSPLTYGTPGLTNAEVHARRLLPSWTLHFAK
Download sequence
Identical sequences A0A0D1DPS4
UM05433 XP_011392118.1.11705 5270.UM05433.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]