SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1MM96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1MM96
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Barstar-related 7.72e-28
Family Barstar-related 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1MM96
Sequence length 92
Comment (tr|A0A0D1MM96|A0A0D1MM96_KLEAE) Uncharacterized protein {ECO:0000313|EMBL:KIU31527.1} KW=Complete proteome OX=548 OS=Klebsiella aerogenes (Enterobacter aerogenes). GN=SR38_17905 OC=Enterobacteriaceae; Klebsiella.
Sequence
MHIYTFDFDEIIDQADFYRDFARQFGLPKQQVNNLDSLWDVVTEGGVPLPLEIEFVHLSE
ENRRRFGALILLFDEAEEELDGQLRFNIRHST
Download sequence
Identical sequences A0A0D1MM96 H5V5K7
WP_002437476.1.100163 WP_002437476.1.91987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]