SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1WEJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1WEJ2
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.31e-28
Family Co-chaperone p23-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1WEJ2
Sequence length 206
Comment (tr|A0A0D1WEJ2|A0A0D1WEJ2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV87240.1} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_02798 OC=Exophiala.
Sequence
MSTQVTPEVLWAQRSSTSDPEKNYVYLTIGVVDVPPKTLKLDLKPTGLTFTGTSDSKKTT
YHLEMEFYDEIDVENSKTHHTPANIQLVLRKKELKEEYWPRLLKDKAKVHYLRTDFDKWV
DEDEQNEAPEDDYMNQFGGGMGEDGGFGGIDFSKLGGGGGDMPGMEGLGGGEDAGGDDEE
EDDDDMPDLEEDEAEGDAKGKGKAAA
Download sequence
Identical sequences A0A0D1WEJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]