SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D1XE59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1XE59
Domain Number 1 Region: 6-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-79
Family Capz beta-1 subunit 0.0000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1XE59
Sequence length 273
Comment (tr|A0A0D1XE59|A0A0D1XE59_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV86326.1} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_01943 OC=Exophiala.
Sequence
MANEVQFDAALDLLRRLSPLKVSENLTAITTLVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANTAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKNVAQEAGWDSIHVFEVDERRGSGRTCHYKLTSTVILHLGRESE
GVGSLTLAGSMTRQVEADLVVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEVYFGKA
KDVVGDLRSVAPLTGVNRDRQAQRDVISSMGGK
Download sequence
Identical sequences A0A0D1XE59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]