SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D1XYU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1XYU3
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-85
Family Capz beta-1 subunit 0.0000000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1XYU3
Sequence length 270
Comment (tr|A0A0D1XYU3|A0A0D1XYU3_9PEZI) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KIW07946.1} KW=Complete proteome; Reference proteome OX=253628 OS=Verruconis gallopava. GN=PV09_01849 OC=Sympoventuriaceae; Verruconis.
Sequence
MGDSQFDAALDILRRLNPKHTAKNLDQIVAIAPALSEDLYESVDVPLSTRKCRKSGKDYL
ICDYNRDGDSYRSPWSNEFDPPLSDGVVPSDRVRKMEIRANEGFDVYRELYYEGGVSSVY
FWDVDDGFAGCVLLKKGVAPNSKSSGSWDSIHVFEVQDKARVSHYKLTSTVILSLGSETD
ALGSMDLSGNMVRQVEQDMPVEDDNSHVANIGRLVEDMELKMRNLLQEVYFGKAKDVVGD
LRSIQPLSEAQRDRNAHQEMINSMGGASIR
Download sequence
Identical sequences A0A0D1XYU3
XP_016217815.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]