SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1YYI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1YYI7
Domain Number 1 Region: 72-259
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.19e-43
Family TRAPP components 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1YYI7
Sequence length 264
Comment (tr|A0A0D1YYI7|A0A0D1YYI7_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV87667.1} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_03198 OC=Exophiala.
Sequence
MAVPPGMTMPSYPPPPSHTSSPSRHISTYSMSSTTLAGGTSTPTSTTTAALRYPSTRKTI
YDRNLNRSRNAELSRSSFAYLFMEMVSYAQRRVKGIADFEKRLNEQGYPLGLKLLDLLLY
RATPAGSSSSSSTGSSGGTSGAANRPLRLLPLLTLLTTKLYPLLFSRPADSLEQSTTNPG
EYMIIDNTPLTNQYISVPKEMNQLSVAAYIAGIIEGVCDGAGFECKASAHNTGTDVWPNR
TVFLIKFEDHVLEREKELERQGVK
Download sequence
Identical sequences A0A0D1YYI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]