SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2A5H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2A5H5
Domain Number 1 Region: 338-537
Classification Level Classification E-value
Superfamily MIR domain 5.58e-60
Family MIR domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2A5H5
Sequence length 921
Comment (tr|A0A0D2A5H5|A0A0D2A5H5_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW35611.1} KW=Complete proteome; Reference proteome OX=569365 OS=Cladophialophora immunda. GN=PV07_02297 OC=Cladophialophora.
Sequence
MAHAPSRKNAASQKAASPAPASREVSSDMIRTQSSKKKSYASDGVTDNDIFLLPMGDYQI
MALLTLLAGVVRLFKIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLAGWL
AGFNGDFDFKDIGKDYLEPKVPYVSMRLLPAILGVLTIPTMFLTLKAYGCRTVTACLGSA
LLIFENGLITQSRLILLDSPLVICTAFTALAWTCFTNQHELGPERAFDASWWFWLAATGL
GLGATASVKWVGLFTIAWVGSLTILQLWVLLGDSVNVTPRKWFKHFFARVFCLIVIPIAF
YVGMFGIHFLCLVNPGDGDGFMSSEFQATLNNKGMADTPADVLFGSEVTIRHHNTQGGYL
HSHSHMYPGGSKQQQVTLYPHKDENNIFLLENQTQPITADNVTVAGPKAWSNLTEYIKDG
DIIRLYHLTTHRRIHSHDVRPPITEAEWQNEVTAYGYEGFEGDANDLFRVEIVKSMSDGE
EAKKRLRTIQTKFKLVHIMTGCVLFSHKVKLPDWGFEQQEVTCAKGGTLPNSVWYVEQNQ
HPMLGEDAEKVNYRNPGFLGKFWELQKVMWRTNAGLVESHAWDSRPGSWPILRRGINFWG
KDHRQIYLLGNPAIWWPSSLAILTYIIFKGISVLRWQRSCNDYSNVNFKRFDYEVGQTVL
AWAFHYFPFYLMARQLFLHHYFPALYFAIMALCQIFDFVVNRISSLGLKKYPEIGWSVAV
LFVAFAIGVFTLYAPLIYGNPWTQDQCRAVKLFDTWDFDCNTFHTDIAKYSTPLPPFGEG
GVTPTVPSMQIDSDRKDDPSAVTPQVGEGKVIGQEERVEYRDQNGNLLDEAQVQALLAEG
KASFQTKYETRTRLVDEQGNEVNPSGVAPDHPDVEGQNPSTKGVPEEQANRSPADAQAGG
SVKKGDDSKAKPASDASEATK
Download sequence
Identical sequences A0A0D2A5H5
XP_016255827.1.39546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]