SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2AYD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2AYD5
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.32e-78
Family Capz alpha-1 subunit 0.0000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2AYD5
Sequence length 265
Comment (tr|A0A0D2AYD5|A0A0D2AYD5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KIW04179.1} KW=Complete proteome; Reference proteome OX=253628 OS=Verruconis gallopava. GN=PV09_04492 OC=Sympoventuriaceae; Verruconis.
Sequence
MSARNTALSDFIASAPPGELNNVITAIKTLSGDPNVTSTLGPALQKYNEDQFTAVKLPGA
SQPVIVSSYNRLEDGRYFDVESKSSWTYDHIAQKASNVQSYVPDSPHDELIKSLYKSLSK
HVSEHYPSASLGIYPSSDGVHILTVSSKYSPSNFYNGRFRSHYIYSPSSNQLRGTITVDV
HYYEDGNVRLLTNKKIDETVRGDNVAGTIAAAERKYQEELNRGFSGLSEGAFRGLRRQLP
VTRVKVDWEKVSGYRLGQDIGGTRR
Download sequence
Identical sequences A0A0D2AYD5
XP_016214048.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]