SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2D578 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2D578
Domain Number 1 Region: 337-536
Classification Level Classification E-value
Superfamily MIR domain 1.05e-60
Family MIR domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2D578
Sequence length 921
Comment (tr|A0A0D2D578|A0A0D2D578_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW72766.1} KW=Complete proteome; Reference proteome OX=5601 OS=Phialophora americana. GN=PV04_00941 OC=Phialophora.
Sequence
MAVTSARKAAASQKAAPTSTPSQPSRDVVRTQSGKKKSYASEGVTDNDVFLLPMSDYQVM
ALLTLLAAVVRLFRIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLAGWLA
GFKGDFDFKDIGKDYLEPKVPYVSMRLLPAILGVFTIPTMFLTLKAYGCRTVTACLGATL
LIFENGFVTQSRLILLDSPLVICTAFTALAWTCFTNQNELGPDRAFDASWWFWLAATGLG
LGATVSVKWVGLFTIAWIGSLTLVQLWVLLGDSVNVSPRRWAKHFFARMFCLIVIPVAFY
VGMFGIHFLCLVNPGDGDGFMSSEFQATLNNKGMADTPADVLFGSEVTLRHHNTQGGYLH
SHPHMYPGGSKQQQITLYPHKDENNIFLLENQTQPVTPDNVTVTGPQAWGNLTEPVKDGD
VIRLYHLMTHRRVHSHDVRPPVTEAEWQQEVTAYGYEGFEGDANDLFRVEIVKSMSDGDE
AKKRLRTIQSKFKLVHVMTGCVLFSHKVKLPDWGFEQQEVTCAKGGTLPNSVWYIEQNHH
PMLKEQAEKVNYRNPGFLGKFWELQKVMWRTNAGLVESHAWDSRPGSWPILRRGINFWGK
DHRQIYLLGNPAIWWPSTLAILTYIIFKGISVLRWQRSCNDYSNVNFKRFDYEVGQTVLA
WAFHYFPFYLMARQLFLHHYFPALYFAIMAMCQIFDFVFNRISVLGLKKRPEFAWGAAVA
FVAFAIGVFTLYAPLIYGNPWTQDQCRAVKLFNTWDFDCNNFHTDYAKYSTPLPPPFGDA
TPTVPSAQVNSERKDTLGAAISQQIGEGRVIAQEEKVEYRDQDGNLLNEAQVQALLAEGK
ASFQTKYETRTKLVDEQGNEVNPSDIAPPHPDVEGQNPQTKGVPEEQANMSPAEAEAGGS
VKKGDDDSKAKPASDASEATK
Download sequence
Identical sequences A0A0D2D578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]