SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2DIK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2DIK2
Domain Number 1 Region: 338-523
Classification Level Classification E-value
Superfamily MIR domain 3.53e-60
Family MIR domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2DIK2
Sequence length 746
Comment (tr|A0A0D2DIK2|A0A0D2DIK2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW42838.1} KW=Complete proteome; Reference proteome OX=215243 OS=Exophiala oligosperma. GN=PV06_06346 OC=Exophiala.
Sequence
MAAADSGYTTGAGRDDTDLRRRNVASYENANGQHVYKVDAEDVKKLKIQKKSGILEILDE
WEFIIAPIVFTAFALFTRLWKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLV
GLSGYLAGYNGSFEFKSGETYPEGVNYTFMRIFNALFGAVTIPLTYYTARELNFKRPAVW
LMTLMVLCENSYATISRFILLDSMLLCFTFTTVLCWARFHRLQHKSFSIEWFAWLFLTGL
SIGCVCSVKWVGLFATALVGLYTAEDLWNKFGDLKMPKTELAAHVVARVGGLIVIPMLVY
MFSFYLHFLILENSGPGDAQMSSLFQANLRGTEVGKDSPLEIALGSRVTIKNMGYGGGLL
HSHVQTYPEGSGQQQITCYHHKDANNDWFFYPNRSQPEFDPEAPLSFVADKQVVRLVHAQ
TGRNLHSHSVAAPVTKADYEVSCYGNLTVGDEKDHWKVEVVSDAASSDRSRIRTLTTAFR
LRHTELGCYLRAGTVNLPQWGFKQIETTCAKNASPRDVYTHWNVESHVNERLPPGEAKNY
RSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHVGLRMCSWDDSITKYFL
LGNPLVYWGSTASLGVAGLIVLWYLIRWQRGYDELRQTDIDQIHYSGIYPLIGWFFHYLP
FVMMGRVTYVHHYYPALYFAILVSGFCVDWMTRPLNKTVRWGVYSILYAATIGLFVLFSP
IVFGMQGPNKNYAYLRWFNRWRISDA
Download sequence
Identical sequences A0A0D2DIK2
XP_016263054.1.65613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]