SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2G1X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2G1X4
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.37e-79
Family Capz beta-1 subunit 0.0000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2G1X4
Sequence length 273
Comment (tr|A0A0D2G1X4|A0A0D2G1X4_XYLBA) Unplaced genomic scaffold supercont1.9, whole genome shotgun sequence {ECO:0000313|EMBL:KIW92737.1} KW=Complete proteome OX=1442370 OS=Cladophialophora bantiana CBS 173.52. GN=Z519_06585 OC=Cladophialophora.
Sequence
MASEAQFDAALDLLRRLSPLKVSDNLTSITTLVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANTAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKPVAKEAGWDSIHVFEVDERRGSGRTSHYKLTSTVILHLGRESE
GLGSLNLAGSMTRQVEADLVVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEVYFGKA
KDVVGDLRSVAPLTGVNRDRQAQRDVISSMGGK
Download sequence
Identical sequences A0A0D2G1X4
XP_016619406.1.57598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]