SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2GGU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2GGU1
Domain Number 1 Region: 11-216
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.61e-53
Family Pyruvate oxidase and decarboxylase PP module 0.029
Further Details:      
 
Domain Number 2 Region: 266-421
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000314
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2GGU1
Sequence length 432
Comment (tr|A0A0D2GGU1|A0A0D2GGU1_9DELT) 2-oxoglutarate synthase {ECO:0000313|EMBL:KIX14142.1} KW=Complete proteome; Reference proteome OX=1429043 OS=Dethiosulfatarculus sandiegensis. GN=X474_08890 OC=Desulfarculaceae; Dethiosulfatarculus.
Sequence
MADRTLLNLSRPPVFCPGCSHDSVLRTLDKTFVRMGLNGRDIAMVSDIGCSGLFDTFFNT
HAFHGLHGRALTYASGLKLSRPDLNVVVTMGDGGLGIGGAHVLAACRKNLDITLLVLNNF
NFGMTGGQCSATTPNDAQVSSGFLNRLDRPLDLYGVATAAGAPFVMRCSAYQKDLSQIME
QAINYKGFAILEIEGVCPGRYTKRNKITPKTIQEGLDADQRPQGPIPENQRTEYGDAYRA
ECEALEPLGRPLTIEKHFNPPFEGRVSVSLQGSAGQRAITAGELLGLAAQSAGLYATQKN
EYNITVLRGPSITELNFSPVQIGYTGIEKPDVVLALAPEGVERRKEVYAKLGPETLVIQA
AGVEIPETGAQVRLVDFKGQGLKNVDWSLASLAVLAKLNKVITLDMLNLALENRFKGKVL
EISKVLVTNVEP
Download sequence
Identical sequences A0A0D2GGU1
WP_044348004.1.27248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]