SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2HN55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2HN55
Domain Number 1 Region: 329-518
Classification Level Classification E-value
Superfamily MIR domain 5.23e-52
Family MIR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2HN55
Sequence length 779
Comment (tr|A0A0D2HN55|A0A0D2HN55_XYLBA) Unplaced genomic scaffold supercont1.10, whole genome shotgun sequence {ECO:0000313|EMBL:KIW92265.1} KW=Complete proteome OX=1442370 OS=Cladophialophora bantiana CBS 173.52. GN=Z519_07249 OC=Cladophialophora.
Sequence
MSTPNSTLRQRGPKEKNKPVASGEKDDEVLNEALSNVQKTVSKEWDYKLALGVIAALAFA
TRFFGISHPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALVGWLVGYDGHFLFD
NIGESYITNNVPYLAFRGLPAFLGALTVVVVYLIMWESGYSLPACVLAAGLVLFDNSHVG
QTRLILLDATLVFFVSLSIYCYIRFYKQRHDPFGRKWWKWLLLCGFCMSCVISTKYVGAF
TFFTIGCAVLIDLWDLLDINRKGGALDLFTFGKHFVARALGLIIIPFFFYLFWFQVHFAI
LTRSGPGDDFMTPEFQETLSDNLMHQASIDIQYYDYITLRHKDTKVYLHSHPDRYPLRYD
DGRISSQGQQVTGYPFNDTNNEWQILPNAQHPDPAMAGKPVLNGDIVKLRHVVTNTMLLT
HDVASPYFPTNQEFTTVPLEVAAGDRHNDTLFEIRMEQGKKGSPFKTMSGQFKLIHYPTK
VAMWTHTTPLPDWAFKQAEINGNKNAQQSSNIWYVDDIPNLPEDSPRRIKEVKKTKSLPF
YRKYIELQRAMFYHNNALTASHPYATQPYQWPFLLRGVSFWTQDSTKQQIYFLGNPIGYW
IASALLAVFAGILGADQLSLRRGIDALDRRTRSRLYNSTGFFFLCWAAHYFPFYLMGRQL
FLHHYLPAHLASCLVTGALIEFIFNVDPAIDDDTHHAPQQKKDKVTGKIPEKARKHFQTA
AERLKGQSMLGTWAATVVILAAVLYGFYFFFPLTYGWPGLTPAQVNARKWLGYDLHFAK
Download sequence
Identical sequences A0A0D2HN55
XP_016618934.1.57598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]