SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2IS10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2IS10
Domain Number 1 Region: 658-893
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.34e-64
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 895-1056
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.09e-37
Family NADPH-cytochrome p450 reductase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 409-655
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.59e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00066
Further Details:      
 
Domain Number 4 Region: 261-395
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2IS10
Sequence length 1056
Comment (tr|A0A0D2IS10|A0A0D2IS10_9EURO) Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.3, whole genome shotgun sequence {ECO:0000313|EMBL:KIX05921.1} KW=Complete proteome; Reference proteome OX=1442369 OS=Rhinocladiella mackenziei CBS 650.93. GN=Z518_03895 OC=Rhinocladiella.
Sequence
MMAPSTESPPFGPSPPLSSIAGPTYVTAQTLVQQVTYSLSDKIFSYSPETFDLDTAAKAW
TEAEETNIHGYKTAVQSMQIRNGAGSIALGYMFSKDFDLKKRDIPQGLLAPSSALQFLRP
VLDQLSLLYSVGNPLVAHVAALDYEGDKNGGLVSDYVSPLAIAEDLGLGLVLSQSAYEAQ
HMSLLATLLAQDLPTLHVYDGVRTGRETTRVIDVISKSGLGAAYNAVLKSVSDEDRKHLS
LEGKTLRTLRALNEELGTDYKPFEYFGHEQPEAVLVSFGSVESSLAAQAATALAQSGNRV
GAINVRLYRPFAEELFLKLVPKGVRVVGVLGQVVDAQAVQDAGIHSHLYEDVLASISYGT
SIHDTPEVRELKYARAERWTPSSISATFQLLLGKTTDDPGVTTFLDDSVQQYTFWNVDGA
PCASAAAHLAHALTRDSAQNVTMHTTHDNHVQGGIHRIDIRKSPKSLDASYSITSANTIV
VTDVKLLEKIDVLKSSQKGGKMILVLPGVKDEDVEKKLPTAFKRSTVENEISLYLINPGN
TALNAGNSEIESLILQTAFLRVALGKSEAVGLQKLATTNSDIQTLGKVADDLEKTLRQIE
VPKEWAELEVGATKEALPWDISPNSFALFDKTEEEPPSVLHSWQKVAKGLLFKEAYNASS
SLRPDLPTKTYTVHVKENRRLTPLTYDRNIFHIEFDLGRSGLKYDIGEALGIHAENDHDQ
VMEFIKWYGLNPEDVVEVASREDPAIFENRTIYQALMQNVDIFGRPPKKFYEALADFATD
ETEKKNLLTLAGPEGYKEFQRRAEVDTVTFSDILLEFPSAHPSFHDIVRIVSPMKRREYS
IASCQAVTPTSVALMVVVVNWVDSKGRDRFGQATKYLSDLKVGAPVTVSVKPSVMKLPPK
STQPIIMAGLGTGLAPFRAFVQHRAMEKAQGKEIGSVLLYMGSRHQREEYCYGEEWEAYQ
AAGVITLLGRAFSRDQPQKIYIQDRMRQTMDDIVKAYIKEDGAFYLCGPTWPVPDVTNVL
EEAIAKDAKANGVKKIDTGREIMRLKDEGRYVLEVY
Download sequence
Identical sequences A0A0D2IS10
XP_013273057.1.10589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]