SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2IYA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2IYA7
Domain Number 1 Region: 330-519
Classification Level Classification E-value
Superfamily MIR domain 1.18e-52
Family MIR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2IYA7
Sequence length 776
Comment (tr|A0A0D2IYA7|A0A0D2IYA7_9EURO) Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.7, whole genome shotgun sequence {ECO:0000313|EMBL:KIX01535.1} KW=Complete proteome; Reference proteome OX=1442369 OS=Rhinocladiella mackenziei CBS 650.93. GN=Z518_09261 OC=Rhinocladiella.
Sequence
MSTPSSTLRQRGGKEKNKSLANGTQNDKSQTQTLEDTQKKSGSKEWDYRIALGIITILAF
ATRFFGISHPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALVGWLIGYDGHFLF
DNIGESYITNNVPYVAFRALPALLGALTVVVVFLIMWESGYSLPACVLATGLVLFDNSHV
GQTRLILLDATLVFFVSLSILSYIRFYKQRHGPFGRKWWKWLLLTGFCMSCVISTKYVGA
FTFFTIGCAVCLDLWGLLDINRKEGALDLFTFGKHFVARAVGLIVIPFFFYLFWFQVHFA
ILTRSGPGDDFMTPEFQETLSDNLMHQASIDIQYYDYITLRHKDTKTYLHSHPERYPLRY
DDGRISSQGQQVTGYPFNDTNNHWQILPNLPNPDGSQAGTPVLNGDIVKLRHVVTNTMLL
THDVASPYYPTNQEFTTVSLDLAAGDRHNDTLFEIRMEQGKKGQPFRSMSGQFKLIHYPT
KVAMWTHTTPLPEWGFKQAEINGNKNSQQSSNIWYVDEIPSIPADSPRLVKEPKKTKSLP
FYVKYIELQRAMFYHNNALTASHPYATQPFHWPFLLRGVSFWTQDSTKRQIYFLGNPIGY
WIASALLAVFAGILGADQLSLRRGIDALDPRTRSRLYNSTGFFFLCWAAHYFPFYLMGRQ
LFLHHYLPAHLASCLVTGALVEFIFNVDPVLDEEMTAKKDKVTGKLPDKARRTFQTAQER
LKGQSMVATWSAALVILAAVIYGFYFFFPLTYGWPGLTPAQVNARKWLGYDLHFAK
Download sequence
Identical sequences A0A0D2IYA7
XP_013268671.1.10589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]