SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2KMK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2KMK2
Domain Number 1 Region: 765-929
Classification Level Classification E-value
Superfamily MIR domain 8.5e-27
Family MIR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2KMK2
Sequence length 1201
Comment (tr|A0A0D2KMK2|A0A0D2KMK2_9AGAR) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KJA15827.1} KW=Complete proteome; Reference proteome OX=945553 OS=Hypholoma sublateritium FD-334 SS-4. GN=HYPSUDRAFT_58610 OC=Hypholoma.
Sequence
MPLSLQEAMHIREALVGLKHLGIGKGNNFLKKPSESICANILPAYPQRISSLTATGNTPI
PPKQMADITRAIASTRRARYRVRGKAPYSERISGMSLALYATREHEASVPRPEHSGASGR
AWTKDAAENLVVSPFAEILGIRLNALVANTDLSFAELGMDLSTAVQVVKNFQNQRAILTE
FGVNNSPIDRPFPSREIPHHPRRHYRAQSRGTTSHFTATPEAGDITFERRVLSMPPMMSE
VKGTNLGVFIGSSLDVDYHHLLCEEKGFETYSRYYDTGITVRTAYGRLSYSGLVTFYPGY
LSASIKGTHRRLAVKYLHRDDTNEAIYGFLSAQKMTSLNSRCATSANEADGWVIIFPPKA
TSLTQFQPLKYVPCEGNVTYILKTEAAALGGVVVLVEYAGGPTRVMEAGVASNVATRRPS
RYTSKACPLGLPCPPRPYCPARGPYFFLPHVTPETLLILYQGALIRWSQARRGHLARLDL
GNICAHLSISSEHAQLASRLLSMKLAGFPLYFSVLRHSLVTHKNGVYDSKEFSCRCLGPG
DIEKKSPAIAVDFGTDPEFEFEEVQYSNHFWSPNREELPLHYMSEEKARRRVKAGPTIEE
YEHIEIEHYTGREYYDDSGKDLYGKHLEDEAHCGKFGSHYLKCEFYLDVHPALGKMLVGL
ADLLAGYDDSFEFKSGSGGISGRRSLRAYTCHDGAVRRRYGRPGMMSAGCVYPNLSSSTL
YFCSAHSLLFSASPNFIVNNIMAMVIIGSRFHWFANLEGNDFSRNPLEIACGSKITLKNM
GWGGGLLHSHPAAGRLLSLQRREQRMDSHAALGQIAYNPNSARLRFLEDGDDIGPRHAMT
TRNIHSHTVLAPVTKLNYGVSCYGNDTVNDNHDYWQVEVVDDIKLSQVDRIHSLTTHQRF
KHKALECFLRAANAILPWWGFKSRVASCLSRSFFRWRIVTDYSTAANTILCCPDALDHFI
FPFKAFKDVAFGIAGPVNEAKGLKWHERYRIYTLHVIHSLRKFTDHACPEKILPMLSKGD
RAYMDPASSSLQPQPSESPTWLSFYGQKIKSEMDELSALGGVTRLVSRRSSSSPSISALS
PQLQKLASPTLSESVTTLISFLVLIPCWIATPPRQPPMTYVILVPPLDGFICDNTTGNLF
NPLGKPYSIAAQPAKQSRKTPETVEHTRLASALVLLIVAEEFRGDLARCDANLQAMAARA
I
Download sequence
Identical sequences A0A0D2KMK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]