SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2R8P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2R8P8
Domain Number 1 Region: 426-513
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.79e-19
Family C1-like domain 0.021
Further Details:      
 
Domain Number 2 Region: 534-622
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.08e-17
Family C1-like domain 0.018
Further Details:      
 
Domain Number 3 Region: 208-297
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.98e-16
Family C1-like domain 0.037
Further Details:      
 
Domain Number 4 Region: 59-117
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000299
Family C1-like domain 0.022
Further Details:      
 
Domain Number 5 Region: 2-55
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000288
Family C1-like domain 0.019
Further Details:      
 
Domain Number 6 Region: 167-226
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000251
Family C1-like domain 0.071
Further Details:      
 
Domain Number 7 Region: 628-675
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000921
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.016
Further Details:      
 
Weak hits

Sequence:  A0A0D2R8P8
Domain Number - Region: 125-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00023
Family C1-like domain 0.092
Further Details:      
 
Domain Number - Region: 295-346
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00858
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2R8P8
Sequence length 679
Comment (tr|A0A0D2R8P8|A0A0D2R8P8_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB28249.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_005G036900 OC=Gossypium.
Sequence
MEIQHFSHHHPLVFIQAHSVASKAALCLVCEKPVVGWSYGCNQCEFYLHKGCAELELAPK
IQHPFHPKHPLTLLPKSSYSGFGICNFCLKKLGGFFYNCNDCSFYLHINCALLQSSIAAN
FPNSLHPHPLFFIQNHNNEVKSHCSGCQKPISGPFYHCSDCTYPTFFNLHKECAELPLEI
NHPCDRKHALTLLQQPPTHPQKCSCYLCRIQWKGFVYSCSLCNFDFSLDDFLFSPPTITV
ASHEHPWMLVSRKMWFVCDFCGTDGDHSPYHCDTCVLFVHKNCISLPRHIMITRHHHTIS
LSYSFRQNQVEDWMCKICYKEVDISYGHYRCPASRCRYIAHVRCATDKAIWDGTIIPEGY
DERSEEVVDVPWNLISDVVEQIGIGELMVASEIKHSYHAHNLRLTFSGKTKDDNSQCDGC
TRPLSTPFYSCEQCKFFLHKDCAELPKEMPHPFHKHLLTLSNSHDGDDYPLCDACGRRYK
GFSYRCYEGDCCFEIDIQCVLLSDTLKHPSHEHSLFLVHNNEGTSCSACFKGLDLWDVAY
RCMRRCDFSLDVGCATLPLTAWYKYDRHALTLTYSDDSGPSQLYCDLCEKEREPNRWFYY
CAYCDNSLHLNCAIGDLPYMKLGNKFKTYWHKHPFTVVKNIWNCPPCKVCGEACNGQALE
CKESECNFTVHWNCRRRLF
Download sequence
Identical sequences A0A0D2R8P8
Gorai.005G036900.1|PACid:26805326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]