SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2RA05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2RA05
Domain Number - Region: 96-146
Classification Level Classification E-value
Superfamily ACT-like 0.00384
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.053
Further Details:      
 
Domain Number - Region: 135-173
Classification Level Classification E-value
Superfamily Staphylokinase/streptokinase 0.049
Family Staphylokinase/streptokinase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2RA05
Sequence length 215
Comment (tr|A0A0D2RA05|A0A0D2RA05_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB67342.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_010G188200 OC=Gossypium.
Sequence
MAVAMASAANCGVYFSSNTNKLNFPVFDFKNHSWSAAFVTTPPNILEKRSVRLSFSMMGI
IPRATSSATAVESDGSFQDTDTVPTPKVIIDQDSDPDATVVEITFGDRLGALLDTMNALK
NLGLNVSKANVYLDSSGKHNKFAITKASTGRKVEEPELLEAIRLTIINNLLEYHPVITYS
FLLIPNEKSPSKSYQMLICGPGIKFPVSYGCNLRR
Download sequence
Identical sequences A0A0D2RA05
Gorai.010G188200.5|PACid:26756651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]