SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2T6P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2T6P3
Domain Number 1 Region: 61-128
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000563
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2T6P3
Sequence length 133
Comment (tr|A0A0D2T6P3|A0A0D2T6P3_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB71353.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_011G118000 OC=Gossypium.
Sequence
MDEIHEKHMNEDLLLMIWDPYVNIVSIFNDYFPQRPYVNIELDDSKYIGELLAKIKAAKD
RTLKDPMFVQLTNFQLQHDSTMGNYPVGRGDAMQLSALEILAYIGFVGILKSCIDWNTLL
ERFIPRQIVITQA
Download sequence
Identical sequences A0A0D2T6P3
Gorai.011G118000.1|PACid:26807456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]