SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2ULF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2ULF2
Domain Number 1 Region: 719-962
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.45e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0052
Further Details:      
 
Domain Number 2 Region: 17-199
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.35e-20
Family Pyruvate oxidase and decarboxylase Pyr module 0.073
Further Details:      
 
Domain Number 3 Region: 430-614
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-16
Family Pyruvate oxidase and decarboxylase PP module 0.05
Further Details:      
 
Domain Number 4 Region: 265-392
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000217
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2ULF2
Sequence length 1159
Comment (tr|A0A0D2ULF2|A0A0D2ULF2_9PROT) MFS transporter {ECO:0000313|EMBL:KJB93702.1} KW=Complete proteome; Reference proteome OX=1385368 OS=Skermanella aerolata KACC 11604. GN=N826_14220 OC=Rhodospirillaceae; Skermanella.
Sequence
MTLPAVKLDDKYTLESGRVFLTGTQALVRLPMMQRQRDVAAGLNTGCFISGYRGSPLGAF
DQALWKARKFLATNHIQFQPGVNEELGATAVWGSQQVGMFPGARYDGVYSMWYGKGPGVD
RSGDVFKHGNAAGTSRNGGVLVLAGDDHSCKSSTFPHQSEHAFVHAMIPVLNPASVQEFL
DLGMMGWAMSRFSGCWIAFKTIAETVESSASVSIDPLRVDYVLPEFDMPVGGLNIRWPDP
PLEQEERLMKYKLYAALAFARANRLDKTVISSPRPRLGVVTTGKSYLDVRQALDDLEISE
EMASDIGLTVYKVAMTWPLEREGMRRFAQGLEEIVVVEEKRALIENQLKEQLYNWDPDVR
PRVVGKFDEDAHEMLPAYNELSPARIAVTIGRRLLKFFDHEGIRRRVEFLERQENAKTRK
ALVERKPFFCSGCPHNTSTVVPEGSRAVAGIGCHYMATWMDRRTETFTQMGGEGVPWIGQ
APFTDEQHIFANLGDGTYFHSGLLAVRAAIASGVNITYKILYNDAVAMTGGQAHDGSLSV
PQISRQLAAEGATRIVVVTDEPEKYAGTTGLAAGVRVEHRDELDSVQRELREVKGTSILI
YDQTCAAEKRRRRKRKIMVDPPKRVVINEQVCEGCGDCSKKSNCLSVVPVETEFGRKRQI
DQSTCNKDFSCVKGFCPSFVTVHGGQLRKPKPAAAAGSQSAGAEIALPEPSRPGLDHPYG
VLVTGIGGTGVVTIGAILGMAAHIEGKGCSVLDQAGLAQKGGAVTSHIRIAANPEEIHAV
RVAAGGAHLVIGCDVVVTASSDCLSKMAPGHTSAVLNDHETITADFTRNADFRIPSKDLL
AEVTKACGGAEAVTALDATGIATALLGDSIATNLFMLGVAYQKGLVPVSAEAIEQAIELN
AVAVKMNMDAFRWGRRAVVDPGAVKATAAPATAVSVKLSETLDEVIARRVGFLTDYQDAD
YAARYKRQIDWVRQVEGERARGLTGLTEAVARNYFKLLAYKDEYEVARLYTDGAFLKRLG
EQFEGDYKLEFHLAPPMLSETDPATGEPRKKAYGPWMLKVFQGLARMKRLRGTRFDPFGR
TPERKMERQLIADYEKTLGELLSGLNHENHGLAVQIASIPDAIRGFGPVKDRHLADARAK
EAALLEAFRQPAPTPMAAE
Download sequence
Identical sequences A0A0D2ULF2
WP_044431840.1.11806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]