SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D2UU99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2UU99
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-71
Family Capz beta-1 subunit 0.000000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2UU99
Sequence length 255
Comment (tr|A0A0D2UU99|A0A0D2UU99_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB59530.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_009G259800 OC=Gossypium.
Sequence
MEAAMGLMRRMPPRHSETALSALLSLLPHNSSDLLSQVDLPLQVLSDDDSGKRFILCEYN
RDADSYRSPWSNKYHPRLEDAPYPSSKLRQLEIEANDIFTVYCDQYYEGGISSVYMWEDD
NEGFVACFLVKKDGSKTGQGRRGYLEEGTWDAIHVIEVGPEEETTRYCLTSTVMLSLTTD
DVSSGTFSLSGSIRRQMNMNLPVADGHLCNMGKMIEEMEGKLRNSLDQVYFGKTREMVCT
LRPPSEVLPMRLPDS
Download sequence
Identical sequences A0A0D2UU99 A0A1U8PER9
Gorai.009G259800.1|PACid:26765901 XP_012446281.1.20347 XP_016698301.1.88148 XP_016748753.1.88148 XP_017637828.1.75545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]