SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2XA63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2XA63
Domain Number 1 Region: 15-134,167-201
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 5.75e-38
Family Arp2/3 complex 16 kDa subunit ARPC5 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2XA63
Sequence length 201
Comment (tr|A0A0D2XA63|A0A0D2XA63_FUSO4) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_00778 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSIIQQHTSATLGDAWRTINIDALNEDSSVNFDTSTLHPPQPEIDEAEVRQLSGQIRQLL
RGGDAEGALRGSLETPVYNGTDAAKDAHLHTIIEVLQSIKASDMSPLLKSIYGSEGGPEC
LDVLMKYIYKGMATVHPGTASRSPNKVTPQSTGGFSQIAGRPGSNEPATAAMSVLLSWHE
KVVEVAGLGCIGRTMTDWRKV
Download sequence
Identical sequences A0A0D2XA63 A0A2H3IAS7 A0A2H3T0Z6 A0A2K0WM95 F9FPP7 N1RHJ5 N4TXE3 W9IL60 W9LAQ6 W9Q4B9 X0AX04 X0DN68 X0JP80 X0KSR0 X0LQ60
FOXG_00778T0 XP_018233074.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]