SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2XAG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2XAG7
Domain Number 1 Region: 130-239
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 6.67e-26
Family Elongation factor TFIIS domain 2 0.0034
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 7.85e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 
Domain Number 3 Region: 253-306
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.49e-16
Family Transcriptional factor domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2XAG7
Sequence length 323
Comment (tr|A0A0D2XAG7|A0A0D2XAG7_FUSO4) Uncharacterized protein {ECO:0000313|EnsemblFungi:FOXG_00882P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN= OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MPMDERELGQRIKALTKCVAANEPPENAIKLLETLKKDASPTEEMLRATRAGVFVGKLRS
NSNKDIARAAAELVNKWKKLVEQEKHSKLRAKVGSGSPAPAPSSAPASSPAAPPPPSSAG
ASGAKYKGDIEKRKYETDNVNVKRTDSSVRNSCIGLIYNGLAYRSTATENDVITRAVAVE
HAAYTKFKGETPDYKKKIRSLFTNLKNKSNRELGRSVLSGEITAEKFVIMTDDELKSEEQ
RKKELELEKENMKKAQVPMAEKSISESLECGRCKKKQVSYTQAQTRAADEPMTTFCECMA
CGHRWKVTSAYQIHKDPSSSTSC
Download sequence
Identical sequences A0A0D2XAG7
FOXG_00882T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]