SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2XJ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2XJ26
Domain Number - Region: 71-107
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0144
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2XJ26
Sequence length 183
Comment (tr|A0A0D2XJ26|A0A0D2XJ26_FUSO4) Uncharacterized protein {ECO:0000313|EnsemblFungi:FOXG_03935P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN= OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MVSGPVGENTRVYVAAANTAGISGGKDIPAVCTIWGIYQYVDFLFDPINPDFVASKVSRY
SEALNMTLQTLTPTQQGQERLAILRSELDDAKNQAMQDFKDDDNPDKLKSFAQWAPLNAN
AYLVAFQNWEAATNEVQMKPNAIGGAGSALLAAAMKSAANGSNNLTELKGYVPMLSKFPL
PLI
Download sequence
Identical sequences A0A0D2XJ26
FOXG_03935T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]