SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3C0L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3C0L9
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000837
Family C1-like domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D3C0L9
Sequence length 230
Comment (tr|A0A0D3C0L9|A0A0D3C0L9_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo4g142650.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN= OC=Brassica.
Sequence
MSPLPLNAEQVLQHFTHIHPLTKVDGVGTYICDGCKTYGSGRTYRCAACNYDLHEFCAIC
PPTLLSTLHPHHELRNGRVASHCAQPYLLTGLARTYAMAVKPTALGRPTVAPLATTIFTS
SVPYVPLHSSALSSTPRAQVSTPGETCMRHLQRINQRAVYQCKTCGFDVHPLCTQLPKEV
IHNHGYTKQVQVRESHTGSTSKTVRVMVLGAGVAWLCMTGDVSGVVSAFL
Download sequence
Identical sequences A0A0D3C0L9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]