SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3CDV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3CDV7
Domain Number 1 Region: 66-150
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000788
Further Details:      
 
Domain Number 2 Region: 133-206
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 7.72e-24
Family Ribosomal protein L11, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3CDV7
Sequence length 219
Comment (tr|A0A0D3CDV7|A0A0D3CDV7_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo5g049540.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN=106343563 OC=Brassica.
Sequence
MASSALSTLCSSASSSLQPKSNSLSAKLSSKANVSVQFLGKRQSPLLSSTPRFLTVIAMA
PPKPGGKAKKVVGLIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKAGYII
PVEITVFDDKSFTFILKTPPASVLLLKAAGVEKGSKDPKQDKVGVITIDQLSTIAAEKLP
DLNCTTIESAMRIIAGTAANMGIDIDPPVLEPKKKAVLL
Download sequence
Identical sequences A0A0D3CDV7
XP_013638265.1.26608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]